PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_09619A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 342aa    MW: 36567.6 Da    PI: 8.0706
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_09619AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.3e-1767112147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                rg W + Ed +l+++v+q+G+ +W++Ia+++  gR++k+c++rw++ 
  Oropetium_20150105_09619A  67 RGHWRPAEDAKLKELVAQYGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 112
                                899*****************************.***********996 PP

2Myb_DNA-binding52.61e-16119163147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                r ++++eE+e+l+ a++ +G++ W++ ar ++ gRt++ +k++w+ +
  Oropetium_20150105_09619A 119 RRAFSEEEEERLLAAHRAYGNK-WALLARFFP-GRTDNAVKNHWHVL 163
                                678*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.60962113IPR017930Myb domain
SMARTSM007172.2E-1466115IPR001005SANT/Myb domain
SuperFamilySSF466891.3E-2767160IPR009057Homeodomain-like
PfamPF002494.5E-1667112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2668120IPR009057Homeodomain-like
CDDcd001671.11E-1370111No hitNo description
PROSITE profilePS5129426.087114168IPR017930Myb domain
SMARTSM007171.4E-14118166IPR001005SANT/Myb domain
PfamPF002491.1E-13119163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-19121167IPR009057Homeodomain-like
CDDcd001675.75E-7130164No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MAGFFGPVPP APVLPPFLQD QQQQQQVVAE DVYGRVDEVE EDGGAGHVGH VGGGGGGAVV  60
QGKLCSRGHW RPAEDAKLKE LVAQYGPQNW NLIAEKLDGR SGKSCRLRWF NQLDPRINRR  120
AFSEEEEERL LAAHRAYGNK WALLARFFPG RTDNAVKNHW HVLMARKQRE QSGSLRRRKX  180
XXXXXXXXXX XAPSPTAPPA QQQQFAPVVV LHHHHYGSPP SFHGAGAGAG APASTQDAAA  240
TAAAATRAYS AGGDSDETAS TCTTDLSLGS APCFYQSYDM VPRAAAAPAP SAFAHSMRSA  300
FSAPSPAQHH QHQEAASRSR AAGSDNPGAL PFFDFLGVGE T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-33671677107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9648551e-138EU964855.1 Zea mays clone 282116 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457638.11e-114hypothetical protein SORBIDRAFT_03g010960
TrEMBLC5XH761e-114C5XH76_SORBI; Putative uncharacterized protein Sb03g010960
STRINGSb03g010960.11e-114(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-56myb domain protein 105